SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009457 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009457
Domain Number - Region: 293-325
Classification Level Classification E-value
Superfamily Kringle-like 0.0903
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009457   Gene: ENSPANG00000008523   Transcript: ENSPANT00000001630
Sequence length 481
Comment pep:known_by_projection chromosome:PapAnu2.0:12:26832579:26889609:-1 gene:ENSPANG00000008523 transcript:ENSPANT00000001630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGTRPQHLLPPQDNRAAMGYQRQDPVIPPQRDLDDRETLVSEHEYKEKTCQSAALFNV
VNSIIGSGIIGLPYSMKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTNTYQSLVNK
TFGFPGYILLSVLQFLYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLST
VIFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVMARAISLGPHIPKTEDAWVFAKPNAI
QAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGF
TQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVT
VMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSYVM
LPIGAAVMVFGFVMAITNPQDCTHGQEMFYCFPDNFSLTNTSESHIQRTTQLSILNISIF
Q
Download sequence
Identical sequences A0A096N9W6
ENSPANP00000009457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]