SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009467 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009467
Domain Number 1 Region: 182-329
Classification Level Classification E-value
Superfamily Cyclin-like 1.56e-76
Family Cyclin 0.000000664
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009467
Domain Number - Region: 155-163
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0889
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009467   Gene: ENSPANG00000009421   Transcript: ENSPANT00000008127
Sequence length 367
Comment pep:known_by_projection chromosome:PapAnu2.0:12:80870375:80871475:1 gene:ENSPANG00000009421 transcript:ENSPANT00000008127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVL
ISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKP
LAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQAAPPVPGGSPRRVIVQ
ASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVY
LLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRL
IQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPNGGASAASSAARDSCAAGAKH
WTMNLDR
Download sequence
Identical sequences A0A096N9X6 A0A0D9SBR0 A0A2K5L1V3 A0A2K5UH13 A0A2K6JLY5 F7CY39
XP_005574385.1.63531 XP_007964508.1.81039 XP_011918277.1.92194 XP_014966585.1.72884 XP_017712406.1.44346 ENSPANP00000009467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]