SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009551 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009551
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 7.46e-32
Family Ribosomal L11/L12e N-terminal domain 0.00000804
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.57e-18
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009551   Gene: ENSPANG00000019164   Transcript: ENSPANT00000001588
Sequence length 165
Comment pep:novel chromosome:PapAnu2.0:2:67905847:67906344:1 gene:ENSPANG00000019164 transcript:ENSPANT00000001588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNDIKVLYLRCTGGEVGATSALAPKIGPLRLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDDIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
Download sequence
Identical sequences ENSPANP00000009551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]