SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009568 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000009568
Domain Number - Region: 118-197
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0547
Family NadC C-terminal domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009568   Gene: ENSPANG00000010168   Transcript: ENSPANT00000019698
Sequence length 752
Comment pep:known_by_projection chromosome:PapAnu2.0:1:205675778:205922006:-1 gene:ENSPANG00000010168 transcript:ENSPANT00000019698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSPENSTLEEILGQYQRSLRERASRSIHQLKCALKEGDVTIGEDAPNLSFSTSVGSED
ARTAWPELQQSHAVNQLKDLLRRQADKESEVSPSRRKMSPLRSLEHEETNMPTMDNLVPI
INDQSQYIHHLEAEVKFCKEELSGLKNKIQAIVLENESLQQELKSQRQEETLREQTLLDA
SGNMQNSWITTGEDSGVGETAKRPFSHDNADIGKAASAGEQLELEKLKLTYEEKYKIQES
QLKFLRKDLAEYQKTCEDLKEQLKHKEFLLAANTSNRVAGLCLKCAQHEAVLSQTHNNVH
MQTIERLMKERDDLMSALVSVRSSLADTQQREASAYEQVKQVLQISEEANFEKTKALIQC
DQLRKELERQAERLEKELASQQEKRAIEKDMMKKEITKERESMGSKMLILSQNIAQLEAQ
VEKVTKEKISAINQLEEIQSQLASREMDVTKVCGEMRYQLNKANMEKDEAEKEHREFRAK
TNRDLEIKDQEIEKLRIELGERKQHLEQEQQKAARAREECLRLTELLGESEHQLHLTRQE
KDSIQQSFSKEAKAQALQAQQREQELTQKIQQMEAQHDKTENEQYLLLTSQNTFLTKLKE
ECCTLAKKLEQISQKTRSEIAQLSQEKRYTYDKLGKLQRRNEELEEQCVQHGRVHEIMKQ
RLRQLDKHSQATAQQLVQLLNKQNQLLLERQSLSEEVDRLRTQDCTQVLCECPGDFRQYT
LGVMNRKNASGNGNEEESHSPYKMTFTQHATI
Download sequence
Identical sequences ENSPANP00000009568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]