SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009630 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009630
Domain Number 1 Region: 90-205,253-339
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.01e-20
Family DNA gyrase/MutL, N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009630
Domain Number - Region: 818-853
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0124
Family RILP dimerisation region 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009630   Gene: ENSPANG00000023595   Transcript: ENSPANT00000025232
Sequence length 943
Comment pep:known_by_projection chromosome:PapAnu2.0:X:96067291:96126488:-1 gene:ENSPANG00000023595 transcript:ENSPANT00000025232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLYRGAPAGPGAPGCGLARPGGGPQAFGIRLSTVGPGPEGADARAGPWAAGGARGARGE
GPAGRGLTRDGTFSRPQMSPRYLQSNSSSHTRPFSAIAELLDNAVDPDVSARTVFIDVEE
VKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGVFGNGFKSGSMRLGKDAL
VFTKNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNKKMIITEDSLPSLEAILNYSIF
NSENDLLAQFDAIPGKKGTRVLIWNIRRNKNGKSELDFDTDQYDILVSDFDTEEKMTGGI
TSELPETEYSLRAFCGILYMKPRMKIFLRQKKVTTQMIAKSLANVEYDTYKPTFTNKQVR
ITFGFSCKNSNQFGIMMYHNNRLIKSFEKVGCQVKPTRGEGVGVIGVIECNFLKPAYNKQ
DFEYTKEYRLTINALAQKLNSYWKEKTSQYNFETSAVARPIPRVPDQTWVQCDECLKWRK
LPGKIDPSMLPARWFCYYNSHPKYRRCSVPEEHELIDEDLCLSKAKKQEQTVEEKKKMPM
ENENHQVFSNPPKILTIQEMAGLNNKTIGYEGIHSPSVLPSGGEESRSPSLQLKPLDSSV
FQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSS
ERSTPPYLFPEYPEASKNTGQNREVSILYPGTKDQRQGSLLPEELEDQMPRLVAEESNRS
STSINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVAS
AAIPAAATGEKGRGYEENEGRNTPKMKNQRELEELKRTTEKLERVLAERNLFQQKVEELE
QERNHWQSEFKKVQHELVIYSTQEAEGLYWSKKHMGYRQAEFQILKAELERTKEEKEELK
EKLKEAETHLEMLQKAQGFGKAYAATYPRQLSPYFCPPSLGAS
Download sequence
Identical sequences ENSPANP00000009630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]