SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009660 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009660
Domain Number 1 Region: 60-362
Classification Level Classification E-value
Superfamily Kelch motif 8.5e-48
Family Kelch motif 0.026
Further Details:      
 
Domain Number 2 Region: 1822-2000
Classification Level Classification E-value
Superfamily Fibronectin type III 8.34e-19
Family Fibronectin type III 0.000033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009660
Domain Number - Region: 362-407
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00128
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009660   Gene: ENSPANG00000024276   Transcript: ENSPANT00000026085
Sequence length 2035
Comment pep:known chromosome:PapAnu2.0:X:141418942:141445430:-1 gene:ENSPANG00000024276 transcript:ENSPANT00000026085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAVSPANSPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSV
PANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAART
QGVPAVLKVTGPQATTGTPLVTMRPTSQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSS
PQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPV
MVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKT
ITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGT
ILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQ
AGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPG
QPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGH
STSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQV
TLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCET
HETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPC
ETHETGTTTTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACA
AGTPAVIRISVATGALEAAQGSKPQCQTRQTSTTSTTMTVMATGAPCSAGPLLGPSMARE
PGGRGPAFVQLAPLSSKVRLSSPGSKDLPAGRHSHVANTTAMARSSMGAGEPRTAPACES
LQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNP
PCETHETGTTHTATTATSNGGTGQPEGGQQPPAGHPCETHQTTSTGTTMSVSMGALLPDA
TSSHRTLESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNM
SSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPP
PEELQVSPGPRQQLPPRQLLQSASTALMGESTEVLSASQTPELPAAVDLSSTGEPSSGQE
SASSAVVATVVVQPPPPAQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEA
AAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQAT
TIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTV
PSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPP
PSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDSGTVPDYNQLKKQELQPGT
AYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKI
IEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAII
FRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ
Download sequence
Identical sequences A9CB52
ENSPANP00000009660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]