SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009669 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009669
Domain Number 1 Region: 369-524
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.36e-41
Family Eukaryotic proteases 0.00043
Further Details:      
 
Domain Number 2 Region: 196-305
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-33
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 6.54e-19
Family Fibronectin type II module 0.0056
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000395
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000009669
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0223
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009669   Gene: ENSPANG00000008365   Transcript: ENSPANT00000028806
Sequence length 636
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170769634:170779410:-1 gene:ENSPANG00000008365 transcript:ENSPANT00000028806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLGFLLVSLESTLSIPPWKAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRRLYHK
CTHKGRPGPQTWCATSPNFDEDQRWGYCVEPKKVKDHCSKHSPCQKGGTCVNTLSGTHCL
CPQHLTGNHCQREKCFEPQLLRFFHENEIWYRSEQAAVARCQCKGPDAHCQQLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGPFCDLDTKASCYDGRGLSYRGLARTTLSGAPCQP
WTSEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLIGDRLSWEYCDVAQCQAPTQ
AAPPTPVSPGLHVPLMPPQPAPPKLQPTTRTPPQSQTPGALPVKQEQPPRLTRNGSVSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERHNHSCEQCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSEPALCQVAGWGHQFEGAEEYSSFLQEAQGSSRAAPMHARVIPEAR
WCVRTKPQSAGSPCKASSAGDRAVVTATSQASTPMWPTTWPGSGSTPLPDCSGTHLSLLG
DSAVGEWLGHGRQNCVPFPQCGQLRARMAQELNKVL
Download sequence
Identical sequences ENSPANP00000009669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]