SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009685 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009685
Domain Number 1 Region: 104-191
Classification Level Classification E-value
Superfamily Histone-fold 2.73e-33
Family TBP-associated factors, TAFs 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009685   Gene: ENSPANG00000007263   Transcript: ENSPANT00000018230
Sequence length 201
Comment pep:novel scaffold:PapAnu2.0:JH684996.1:1276:1881:1 gene:ENSPANG00000007263 transcript:ENSPANT00000018230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPMETGRQAGVSAEMFAVPRGLKGSNKVGIPEDLDGNLEEPRFQEGELSSQDVTDLTEGD
NEASASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMSTLLSAMSEEQLARYEVCRRSAFP
KARVARLMRSISGSSVSENTAIAMAGIAKVLVGEVVEEALDVCEMWGETPPLQPKHLREA
VRRLKRKGLFPNSNHRKNMFF
Download sequence
Identical sequences ENSPANP00000009685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]