SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009717 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009717
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 3.11e-29
Family Ribosomal protein L37ae 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009717   Gene: ENSPANG00000024942   Transcript: ENSPANT00000008267
Sequence length 92
Comment pep:known_by_projection chromosome:PapAnu2.0:5:85568793:85569086:1 gene:ENSPANG00000024942 transcript:ENSPANT00000008267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISEHAKYTCSFCGKTKMKRRAVGIWHCGSR
MKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ
Download sequence
Identical sequences ENSPANP00000009717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]