SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009972 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009972
Domain Number 1 Region: 332-619
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-62
Family Kelch motif 0.0000826
Further Details:      
 
Domain Number 2 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 7.85e-30
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009972   Gene: ENSPANG00000012353   Transcript: ENSPANT00000003445
Sequence length 643
Comment pep:known_by_projection chromosome:PapAnu2.0:X:18916716:18918644:-1 gene:ENSPANG00000012353 transcript:ENSPANT00000003445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYFLSYCKAHGGALLTGYQALRAEGFLCDVTLETEGSEFPAHRSLLACSSDYFRALFKS
HTQESRARVIHLHVPSAAGLQRLLDFIYTAWLSLSMDTVEDTLEAASYLQVTEALGLCGR
YLERQLAPENCCFAANVASRFGLAHTLDAAERCIVRHLRELLARGAGPAGLLELNPTSLR
AVLGAPDVARVPEARLLGLALAWLRQEPTTERLAHCTELLEHVRFGLVPADVLRRVYSGS
GLVLPARVKGLIIQALNYHTTPSRQPLMQGEQTSIRSPQTRILLVGGRRAREVVIEEVVA
PQRAARGRVAAPEPEEEEEELEEEEEEEWELTQNVVAFDVYNHRWRSLTQLPTPLLGHSV
CTAGNFLFVLGGESPSGSVTSPLADSPRVVTAEVHRYDPRFHAWMEVPAMQEARAHFWCG
AVGGRLLAVGGLGAGGEALASVEMYDLRRDRWTAAGALPRALHGHAGAVGDRGVVYISGG
KTGRGEGGASSLRDLYVLGPEEQAWSKRAPMGTARFGHHMAVLRGAVFAFLGRYEPFSEI
ERYDPGADQWTRLRPLPYDRFCYGLAVVEETALLLGGLKWRDSRQVPTRNVVGYDLDLDR
WEDIGCALPWAWSGLQCAVLQLADGGDEEREGEPGEALDLVLG
Download sequence
Identical sequences A0A096NB55
ENSPANP00000009972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]