SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010012 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010012
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.14e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 7-81
Classification Level Classification E-value
Superfamily F-box domain 5.63e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010012
Domain Number - Region: 419-451
Classification Level Classification E-value
Superfamily ARM repeat 0.00455
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010012   Gene: ENSPANG00000007978   Transcript: ENSPANT00000005635
Sequence length 471
Comment pep:known_by_projection chromosome:PapAnu2.0:14:31096317:31132753:1 gene:ENSPANG00000007978 transcript:ENSPANT00000005635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETDTAQLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences A0A096NB87 A0A1D5QSZ2 A0A2K5NYW3 A0A2K5VN46 A0A2K6A1R3 A0A2K6ECV8
ENSMMUP00000007964 ENSMMUP00000007964 9544.ENSMMUP00000007964 NP_001244630.1.72884 XP_011722340.1.29376 XP_011820938.1.47321 XP_011917572.1.92194 ENSPANP00000010012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]