SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010133 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010133
Domain Number 1 Region: 527-657
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-33
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 2 Region: 1393-1535
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 380-514
Classification Level Classification E-value
Superfamily C-type lectin-like 9.11e-31
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 4 Region: 960-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1270-1393
Classification Level Classification E-value
Superfamily C-type lectin-like 7.76e-28
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1107-1253
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-26
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 7 Region: 811-953
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-25
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 190-315
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.98e-23
Family Cysteine rich domain 0.013
Further Details:      
 
Domain Number 9 Region: 663-799
Classification Level Classification E-value
Superfamily C-type lectin-like 5.77e-23
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 10 Region: 317-374
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-22
Family Fibronectin type II module 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010133   Gene: ENSPANG00000017850   Transcript: ENSPANT00000001622
Sequence length 1616
Comment pep:known_by_projection chromosome:PapAnu2.0:12:21786499:21904684:-1 gene:ENSPANG00000017850 transcript:ENSPANT00000001622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSLSWRFSNRSPTTPLRPPPERRERGCELEEQGVCAGQPHCSCPHPKGRNFWDGQMAH
PSSSSFPKPQWVGRGKRGGLSRVPARAPSVRSLWRQGWRSGSPGPRSIEAPGGVGRGGGC
GSASALQGRVLGVRLWAPGTRGARRAQWLAMLLSPSLLLLLLLLLLGAPRGYAEDVAAAL
TPERLLEWRDKGIFIIQSESLKKCIQAGKSVLTLENCKQANKHMLWKWVSNHGLFNIGGS
GCLGLNLSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVASRKYFHK
WISYVSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATT
SRYERDEKWGFCPDPTSAEVSCDTIWEKDLNSHICYQFNLLSSLSWSEAHSSCQMQGGAL
LSITDETEENFVREHMSSKAVEVWIGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEPFVE
NHCGTFSSFMPSAWRSRDCESTLPYICKKYLNHTDHEIVEKDAWKYYATHCEPGWNPYNR
NCYKLQKEEKTWHKALRSCQADNSALIDITSLAEVEFLVTFLGDENASETWIGLSSNKIP
VSFEWSSDSSVIFTNWHTLEPQIFPNKSQLCVSAEQSEGHWKVKNCEETLFYICKKAGHV
LSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPPALVTITNRFEQAFITSLISS
VVKMKDSYFWIALQDQNDTGEYTWKPAGRKPEPVQYTHWNAHQPRYSGGCVAMRGKHPLG
SWEVKDCRHFKAMSLCKQPVENQETTEHEERWPFHPCYLDWESESGLASCFKVFHSEKVL
TKRTWREAEAFCEEFGAHLASFAHIEEENFVNELLHSKFNWTEARQFWIGFNKRNPLNAG
WWEWSDRTPVVSSFLDNNYFGEDARNCAVYKANKTLLPLHCGSKREWICKIPRDVKPKIP
FWYQYDVPWLFYQDAEYLFHTFASEWSNFGFVCSWLHSDLLTIHSAHEQEFIHSKIKALS
KYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQSQRCGFISSVTGLWGSE
ECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSSWKNWTHA
QHFCAEEAGTLVAIESEVEQAFITMNLFGQTTNVWIGLQNDDYETWLNGKPVVYSNWSPF
DTINIPNHSTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGRGV
NTSDMYPMPNTLEYGNRTYKIINANMTWYAAIKTCLMHRAQLVSITDQYHQSFLTVVLNR
LGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKDEESSLHGDCVFADTNGRWHSTACESFL
QGAICHVPPETRPSEHPELCSETSIPWIKFKSNCYSFSTVLDSMSFEAAHEFCKKEGSNL
LTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNNETMKWFDGTPTDQSNWGIRKPDTD
YFKPHHCVALRIPEGLWQLSPCQEKKGFICKMKADIRTAEELPEKGPSHSIIPLVVVLTL
IVTVAICTLSFCIYKHNGGFFGRLAGFRNPYYPATNFSTVHLEENILISDLEKSDQ
Download sequence
Identical sequences A0A096NBI5
ENSPANP00000010133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]