SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010339 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000010339
Domain Number - Region: 355-398
Classification Level Classification E-value
Superfamily Kringle-like 0.0807
Family Kringle modules 0.017
Further Details:      
 
Domain Number - Region: 182-223
Classification Level Classification E-value
Superfamily RL5-like 0.0824
Family Ribosomal protein L5 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010339   Gene: ENSPANG00000011007   Transcript: ENSPANT00000011095
Sequence length 432
Comment pep:known_by_projection chromosome:PapAnu2.0:11:120432516:120479738:1 gene:ENSPANG00000011007 transcript:ENSPANT00000011095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPACCSCSDVFQYETTKVTRIQSMNYGTIKWFFHVIVFSYVSFALVSDKLYQRKEPVISS
VHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
EYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVYEGNRKTCEVSAWCPIEAVGEAPRPA
LLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGD
NFSDVAIQGGIMGIEIYWDCNLDRWFHHCRPKYSFRRLDDKTTNVSLYPGYNFRYAKYYK
ENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVFIDFLINTYSS
NYCRSHVYPWCKCCQPCVVNEYYYRKKCESVVEPKPTLKYVSFVDESHIRMVNQKLLGRS
LQHVKGQEVPVS
Download sequence
Identical sequences ENSPANP00000010339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]