SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010459 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010459
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Kelch motif 3.01e-52
Family Kelch motif 0.0000165
Further Details:      
 
Domain Number 2 Region: 35-151
Classification Level Classification E-value
Superfamily POZ domain 1.97e-35
Family BTB/POZ domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010459   Gene: ENSPANG00000007135   Transcript: ENSPANT00000025289
Sequence length 502
Comment pep:novel chromosome:PapAnu2.0:5:154597410:154701584:1 gene:ENSPANG00000007135 transcript:ENSPANT00000025289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPLPPACTKQGHQKPLDSKDDNTEKHCPVTVNPWHMKKAFKVMNELRSQNLLCDVTI
VAEDMEISAHRVVLAACSPYFHAMFTGEMSESRAKRVRIKEVDGWTLRMLIDYVYTAEIQ
VTEENVQVLLPAAGLLQLQDVKKTCCEFLESQLHPVNCLGIRAFADMHACTDLLNKANTY
AEQHFTDVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVNHDKDVRQEFMAR
LMEHVRLPLLPREYLVQRVEEEALVKNSSACKDYLIEAMKYHLLPTEQRILMKSVRTRLR
TPMNLPKLMVVVGGQAPKAIRSVECYDFKEERWHQVAELPSRRCRAGMVYMAGLVFAVGG
FNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDGSTGLSSVEAY
NIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDGASRQCLSTVECYNATTNEWSYIA
EMSTRRSGAGTCEPVLAIEAQK
Download sequence
Identical sequences ENSPANP00000010459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]