SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010633 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010633
Domain Number 1 Region: 1816-1983
Classification Level Classification E-value
Superfamily Fibronectin type III 2.73e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 2 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 3.26e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 3 Region: 1635-1806
Classification Level Classification E-value
Superfamily Fibronectin type III 5.53e-25
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 4 Region: 909-1079
Classification Level Classification E-value
Superfamily Fibronectin type III 7.03e-25
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 4.2e-23
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 6 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-22
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.4e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 5.93e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000811
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 11 Region: 2219-2262
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000345
Family Fibronectin type III 0.00000305
Further Details:      
 
Domain Number 14 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000126
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 472-511
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000284
Family Fibronectin type I module 0.0000611
Further Details:      
 
Domain Number 17 Region: 2174-2217
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000458
Family Fibronectin type I module 0.004
Further Details:      
 
Domain Number 18 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000275
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2262-2303
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 2076-2152
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000177
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 23 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000034
Family Fibronectin type I module 0.00035
Further Details:      
 
Domain Number 24 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000185
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010633   Gene: ENSPANG00000005725   Transcript: ENSPANT00000005211
Sequence length 2356
Comment pep:known_by_projection chromosome:PapAnu2.0:12:77245129:77320732:-1 gene:ENSPANG00000005725 transcript:ENSPANT00000005211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYEISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENQESTPVFIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPP
RARITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHVSGRPREDRVPPS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVFAQNPSGESQPLVQTAVTTIPAPTDLKFTQVTPTSLS
AQWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTL
TSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQR
TIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSL
LVSWQPPRARITGYIIKYEKPGSSPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNN
QKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITHPGYDTGNGIQLPGT
SGQQPTVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGQEALSQTTISWAPFQDTS
EYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTV
GNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCHCLGFGSGHFRCDSSRW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIE
CFMPLDVQADREDSRE
Download sequence
Identical sequences A0A096NCS4
ENSPANP00000010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]