SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010724 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010724
Domain Number 1 Region: 208-339
Classification Level Classification E-value
Superfamily TPR-like 1.48e-27
Family Tetratricopeptide repeat (TPR) 0.0043
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000167
Family FKBP immunophilin/proline isomerase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010724   Gene: ENSPANG00000021393   Transcript: ENSPANT00000003106
Sequence length 349
Comment pep:known_by_projection chromosome:PapAnu2.0:4:31422816:31423865:-1 gene:ENSPANG00000021393 transcript:ENSPANT00000003106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPAVSTTGEKDTSQPQQQWEKNLRENFDSVTQIRQQPRDPPTETLELGVSPDPASQIL
ENTQGTEKLVAELEGDSHKSHGSTSQMPQALQASDLWYCPDGSFVKKIIIRGHGLDKPKL
GSCCRVLALGFPFGSGSPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGH
SGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNAEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLEKATADLKKVLAIDPKNRAAQEELGKVVIQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences A0A096ND01
ENSPANP00000010724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]