SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010748 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010748
Domain Number 1 Region: 52-159
Classification Level Classification E-value
Superfamily FKBP-like 1.7e-43
Family FKBP immunophilin/proline isomerase 0.0000937
Further Details:      
 
Domain Number 2 Region: 7-37
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000496
Family WW domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010748   Gene: ENSPANG00000008464   Transcript: ENSPANT00000004524
Sequence length 163
Comment pep:known_by_projection chromosome:PapAnu2.0:19:8758886:8772719:1 gene:ENSPANG00000008464 transcript:ENSPANT00000004524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Download sequence
Identical sequences A0A0A0MWZ5 A0A2K5CB38 A0A2K5NZD5 A0A2K5S4N8 A0A2K5ZIQ9 A0A2K6CFL7 G3SBW6 H2NXH5 H2QFA4 I2CYP4 Q13526 U3DP80
gi|5453898|ref|NP_006212.1| ENSPPYP00000010696 NP_006212.1.87134 NP_006212.1.92137 XP_001161990.1.37143 XP_002828684.1.23681 XP_011734143.1.29376 XP_011849652.1.47321 XP_011849661.1.47321 XP_011949129.1.92194 XP_012291756.1.9421 XP_017355503.1.71028 XP_017823273.1.60252 XP_018871907.1.27298 ENSP00000247970 1nmv_A 1pin_A ENSP00000247970 ENSP00000466962 ENSPANP00000010748 9598.ENSPTRP00000017779 9600.ENSPPYP00000010696 9606.ENSP00000247970 ENSPTRP00000017779 1pinA ENSP00000247970 ENSP00000466962 ENSPTRP00000017779 ENSPPYP00000010696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]