SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010895 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010895
Domain Number 1 Region: 2-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.02e-103
Family Carbonic anhydrase 0.000000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010895   Gene: ENSPANG00000017180   Transcript: ENSPANT00000012570
Sequence length 260
Comment pep:known_by_projection chromosome:PapAnu2.0:8:81222097:81239334:1 gene:ENSPANG00000017180 transcript:ENSPANT00000012570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHWGYGKHNGPEHWHKEFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRIL
NNGHSFNVEFDDSQDKAVIKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHL
VHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDP
RGLLPESLDYWTYSGSLTTPPLLECVTWIVLKEPISVSSEQMSKFRKLNFNGEGEPEELM
VDNWRPAQPLKNRQIKASFK
Download sequence
Identical sequences A0A096NDF1
ENSPANP00000010895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]