SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010983 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010983
Domain Number 1 Region: 255-370,489-629
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.61e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 
Domain Number 2 Region: 28-235
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.92e-33
Family L-arabinose binding protein-like 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000010983
Domain Number - Region: 340-484
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00141
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010983   Gene: ENSPANG00000006097   Transcript: ENSPANT00000024009
Sequence length 694
Comment pep:known_by_projection chromosome:PapAnu2.0:4:96980336:97437619:1 gene:ENSPANG00000006097 transcript:ENSPANT00000024009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTALVSFVCKSSSKLPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMA
AGILKQALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEK
WSMERLQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRF
GTRFMSLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTE
SQKGKPANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILG
FTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMT
LGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPC
NPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANL
AAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQS
VLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYR
DKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSV
FVAVGEFLYKSKKNAQLEKESSIWLVPPYHPDTV
Download sequence
Identical sequences ENSPANP00000010983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]