SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011254 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011254
Domain Number 1 Region: 56-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011254   Gene: ENSPANG00000007888   Transcript: ENSPANT00000013425
Sequence length 206
Comment pep:known_by_projection chromosome:PapAnu2.0:6:170673870:170678048:-1 gene:ENSPANG00000007888 transcript:ENSPANT00000013425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQAPGAQDSGRS
VHNELEKRRRAQLKRCLERLKQQMPLGADCARYTTLSLLRRARMHIQKLEDQEQRARQLK
ERLRSKQQSLQRQLEQLRGLAGAAERERLRTDSLDSSGLSSERSDSDQEELEVDVESLVF
GGEAELLRGFVAGQEHSYSHGGGAWL
Download sequence
Identical sequences A0A096NED7
XP_005558694.1.63531 XP_010384720.1.97406 XP_017751553.1.44346 ENSPANP00000011254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]