SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011307 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011307
Domain Number 1 Region: 8-120
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.84e-35
Family Ribosomal proteins L24p and L21e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011307   Gene: ENSPANG00000012204   Transcript: ENSPANT00000006417
Sequence length 141
Comment pep:known_by_projection chromosome:PapAnu2.0:6:166351267:166359186:1 gene:ENSPANG00000012204 transcript:ENSPANT00000006417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFNPFVTSDRSKTRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKILERKAK
SRQVGKEKGKYKEELIEKMQE
Download sequence
Identical sequences ENSPANP00000011307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]