SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011696 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011696
Domain Number 1 Region: 7-100,220-357
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.57e-65
Family Phosphate binding protein-like 0.000000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011696   Gene: ENSPANG00000003099   Transcript: ENSPANT00000005849
Sequence length 527
Comment pep:known_by_projection chromosome:PapAnu2.0:14:110249155:110331391:1 gene:ENSPANG00000003099 transcript:ENSPANT00000005849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGEL
IARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWL
FMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGS
TIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGT
IHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLLESTMNEY
YRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWWEGGKC
PKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVSVCQEMVAEL
RSIILCQDSIHPRRRRAGVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEA
ALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE
Download sequence
Identical sequences ENSPANP00000011696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]