SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011806 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011806
Domain Number 1 Region: 493-738
Classification Level Classification E-value
Superfamily Kelch motif 3.4e-43
Family Kelch motif 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011806   Gene: ENSPANG00000023997   Transcript: ENSPANT00000000518
Sequence length 777
Comment pep:known_by_projection chromosome:PapAnu2.0:1:20776001:20778334:1 gene:ENSPANG00000023997 transcript:ENSPANT00000000518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPRGAEAQDWHLDMQLTGKVVLSAAALLLVTVAYRLYKSRPAPAQRWGGNAQAEAKEEA
EGSGQPAAQEASPGALQRGPRRRRSSKGSEAPQGCSWENPRGPCVLVTGATSTDRKPQRK
GSGEELGGQGSDSEQGPPSCRGQEARTAVGGNPDPPHLPRLGSEPHSTPAGLIAAADGTC
AGGEPAPWQDGKRPEPPGLGQLEPPHCHHVAPLQGSRDMNQSWVFTRVIGVSREEPGALQ
AASDVGLTLHQQEGAPNASYTFSSIARVRMEENFIQKVEGVEPRLKGKVYDYYVESTSQA
IFQGRLAPRTAALTEVPSPRPPPGSLGTGAASGGQAGDTKGAAGRAASPQPGPSPSNRGF
SRKESFLQIAENPELQLQPDGFRLPAPPCPDPGALPDSDRSSRESHVHLVAGTNFFHVPL
TPASAPQVRLDLGNCYEVLTLAKRHNLEALKEAAYKVMSENYLQVLRSPDIYGCLSGAER
ELILQRRLQGRQYLVVADVCPKEDSGGLCCYDDEQDVWRPLARLPPEAVSRGCAICSLFN
YLFVVSGCQGPGHQPSSRVFCYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGGECLN
SVERYDPRLDRWDFVPPLPSDTFALAHTATACAKEIFVTGGSLRFLLLRFSAQEQRWWAC
PTGGSKDRTAEMVAVNGFLYRFDLNRSLGIAVYRCSASTRLWYECATYRTPYPDAFQCTV
VDNLIYCVGRRSTLCFLADSVSPRFVPKELQSFPAPQGTLLPTVLTLPTPDLPQTRV
Download sequence
Identical sequences ENSPANP00000011806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]