SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011936 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011936
Domain Number 1 Region: 40-194
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.57e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.00000025
Further Details:      
 
Domain Number 2 Region: 199-345
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.18e-36
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011936   Gene: ENSPANG00000022683   Transcript: ENSPANT00000014390
Sequence length 396
Comment pep:known_by_projection chromosome:PapAnu2.0:11:44886136:44890814:-1 gene:ENSPANG00000022683 transcript:ENSPANT00000014390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGKVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPSPGDFAPVFARRLRAGDSV
LAPGGDALQPTRVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAAQPTGMHWYSRLLYRLAEELLG
Download sequence
Identical sequences A0A096NG69
ENSPANP00000011936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]