SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011993 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011993
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 1.44e-42
Family Nucleoplasmin-like core domain 0.00000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011993   Gene: ENSPANG00000001071   Transcript: ENSPANT00000006993
Sequence length 249
Comment pep:novel chromosome:PapAnu2.0:2:48415418:48416384:1 gene:ENSPANG00000001071 transcript:ENSPANT00000006993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDISPMRPQNYLFSCELKADKDDHFKVDNDENEHQLSLRMVRLGAGAKDELLIV
EAEAMNYEGSPIKVTLATLKISVQPMVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDSESEDEEEEDVKLLSISGKQSAPGGGNKIPQKRVKLEEAEEKAPVKKSIRDTPAKNPQ
KSNQNGKDSKPSSTPRSKGQESFKKQAKTPKTPKEPSVEDIKAKMQASIEKAGNNLTLGS
LKHFLLTAV
Download sequence
Identical sequences ENSPANP00000011993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]