SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012014 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012014
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.09e-23
Family Ribosomal L11/L12e N-terminal domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 74-143
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00000000000693
Family Ribosomal protein L11, C-terminal domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012014   Gene: ENSPANG00000000528   Transcript: ENSPANT00000005247
Sequence length 159
Comment pep:novel chromosome:PapAnu2.0:1:11759383:11759876:1 gene:ENSPANG00000000528 transcript:ENSPANT00000005247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSKFDPGEIKVAYLRCTGKVGARSALLPKIGPLGLSPKKVGDDVTKATSNWKGLRITVK
LTIRNRWAQIEVLPSTSALIIKALKEPPRDRKKQKNIKHRGNTTFDEIVNIARQMRPREC
FGTIEEILGTAQPVGCKADGRHPPDIIDDNSGAVECPAN
Download sequence
Identical sequences ENSPANP00000012014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]