SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012065 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012065
Domain Number 1 Region: 55-138
Classification Level Classification E-value
Superfamily E set domains 2.99e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012065
Domain Number - Region: 145-196
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00109
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012065   Gene: ENSPANG00000010656   Transcript: ENSPANT00000006373
Sequence length 384
Comment pep:known_by_projection chromosome:PapAnu2.0:6:152156080:152298775:-1 gene:ENSPANG00000010656 transcript:ENSPANT00000006373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEGTPSYLEHATPCIKAI
SPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTL
SYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQKVIPRHPGDPERLPKEVILKRAADLVE
ALYGMPHNNQEIILKRAADIAEALYSVPRNHNQLPALANTSVHAGMMGVNSFSGQLAVNV
SEASQATNQGFTRNSSSVSPHGYVPSTTPQQTNYNSVTTSMNGYGSAAMSNLGGSPTFLN
GSAANSPYAIVPSSPTMASSTSLPSNCSSSSGIFSFSPANMVSAVKQKSAFAPVVRPQTS
PPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences XP_013209584.1.66349 XP_016864690.1.92137 ENSPANP00000012065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]