SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012066 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012066
Domain Number 1 Region: 3-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-45
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 2 Region: 312-426,546-582
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.87e-36
Family Phosphate binding protein-like 0.00000148
Further Details:      
 
Domain Number 3 Region: 440-543
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000157
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012066   Gene: ENSPANG00000017117   Transcript: ENSPANT00000008637
Sequence length 617
Comment pep:known_by_projection chromosome:PapAnu2.0:6:147089967:147209638:1 gene:ENSPANG00000017117 transcript:ENSPANT00000008637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGL
SVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQ
IIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDA
RDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGI
DIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDA
QAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYR
LEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGIS
IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRD
QTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRHKVKNLEPGQCIFYKFCAQAY
YIGGKLVVAHVLTLTGQ
Download sequence
Identical sequences ENSPANP00000012066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]