SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012090 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012090
Domain Number 1 Region: 184-348
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-29
Family Kelch motif 0.015
Further Details:      
 
Domain Number 2 Region: 8-164
Classification Level Classification E-value
Superfamily Kelch motif 3.27e-25
Family Kelch motif 0.035
Further Details:      
 
Domain Number 3 Region: 348-390,629-773
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-23
Family Fibronectin type III 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012090   Gene: ENSPANG00000018237   Transcript: ENSPANT00000005162
Sequence length 784
Comment pep:known_by_projection chromosome:PapAnu2.0:11:103291701:103331460:1 gene:ENSPANG00000018237 transcript:ENSPANT00000005162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWF
LPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPS
GLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIP
VTKGVVPSPRESHTAVIYCKKDSGGPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGT
VPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLV
SSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKA
TTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQGSNNIVPNS
INDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEG
PHTSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAVVKDETSLT
TFSTKSEVDETYALPATKISRVETHATAMPFSKETPSNPVATMKAGERQWCDVGIFKNNT
ALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQDLVPGTGYRFRVAAINGCGIGPFSKIS
EFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQIQDNPSQL
VFMRIYCGLKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWLQGNNKK
APLN
Download sequence
Identical sequences ENSPANP00000012090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]