SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012103 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012103
Domain Number 1 Region: 274-376
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.31e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 31-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 119-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000144
Family Heme-binding PAS domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012103   Gene: ENSPANG00000006882   Transcript: ENSPANT00000002343
Sequence length 834
Comment pep:known_by_projection chromosome:PapAnu2.0:5:73041891:73120065:1 gene:ENSPANG00000006882 transcript:ENSPANT00000002343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEVCPD
LIFAIMTDGSIIYVSESVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRQHLPAHEKMVQRRSSF
SSQSINSQSVGSSLTQPVMSQATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSSTSTQSQQNVLSGHSQQTSLPSQTQSTLTA
PLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVITSVQQPSQAQLTQPPQQFLQTSRLL
HGNPSTQLILSAAFPLQQSTFSQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ
Download sequence
Identical sequences ENSPANP00000012103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]