SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012183 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012183
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.28e-41
Family NadC C-terminal domain-like 0.029
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012183
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.000144
Family NadC N-terminal domain-like 0.016
Further Details:      
 
Domain Number - Region: 86-118
Classification Level Classification E-value
Superfamily DUSP-like 0.0942
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012183   Gene: ENSPANG00000025368   Transcript: ENSPANT00000019593
Sequence length 491
Comment pep:novel chromosome:PapAnu2.0:3:128402448:128436355:-1 gene:ENSPANG00000025368 transcript:ENSPANT00000019593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKLRKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKQKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIELEAAPH
Download sequence
Identical sequences A0A096NGU4 A0A0D9RG91 A0A2K5N0G9 A0A2K5ULM8 A0A2K6Q253 H9EW35
ENSPANP00000012183 XP_005550528.1.63531 XP_007980707.1.81039 XP_010378971.1.97406 XP_011728769.1.29376 XP_011909997.1.92194 XP_011909998.1.92194 XP_014990151.1.72884 XP_014990152.1.72884 XP_015303393.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]