SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012223 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012223
Domain Number 1 Region: 17-203
Classification Level Classification E-value
Superfamily Ribosomal protein S7 5.62e-54
Family Ribosomal protein S7 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012223   Gene: ENSPANG00000013662   Transcript: ENSPANT00000018076
Sequence length 203
Comment pep:novel chromosome:PapAnu2.0:8:76011126:76011737:1 gene:ENSPANG00000013662 transcript:ENSPANT00000018076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEWKTAAPVVAESPGIKLFGKWSSDDAQIYDISLQDYTAVKEKYAKYLPHSAEQYATKR
FRKTQCPVERLTYSMMMHGRNKRKKLMIVRIVKHAFEIIQLLTGDNPLQVLVNAIINSGP
REDCTCIGRASTVRRQAVDVSPLRRVNQAIWPRCTGALEAAFRNIKTIAECLADELINAA
KGSSNSYAIKKKDELECVAKSNR
Download sequence
Identical sequences ENSPANP00000012223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]