SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012243 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012243
Domain Number 1 Region: 763-854
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000152
Family Canonical RBD 0.021
Further Details:      
 
Domain Number 2 Region: 10-53
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000051
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012243   Gene: ENSPANG00000008712   Transcript: ENSPANT00000012844
Sequence length 894
Comment pep:known_by_projection chromosome:PapAnu2.0:11:60626613:60704028:1 gene:ENSPANG00000008712 transcript:ENSPANT00000012844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNTAAATVVAAGPAAASAAGMGVRPVAGDLSYLRTPGGLCRISASGSENLLG
GPGGASAAPTAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAAS
EVTNSNSAERRKPHSWWGARRPAGPDLQTLPGTEEPLWASRTVNGSRLVPYSCRENYSDS
EEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLSPLTAKSAGGRLETSVQGGGGHAMNDR
AAAAGSLDRSRNLEEAATAEQGGGCDQVDSSPVPRYRVNAKKLTPLLPPPLTDMDSTLDS
STGSLLKTNNHIGGGAFNVDSPRIYSNSLPPSAAVAAASSLRINHANHTGSNHTYLKNTY
NKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTAACLFFLILGLTYLGMRGTGVS
EDGELSIENPFGETFGKIQESEKNLMMNTLYKLHDRLAQLAGDHECGSSSQRTLSVQEAA
AYLKDLGPEYEGIFNTSLQWILENGKDVGIRNRCVGFGPEEELTNITDVQFLQSTRPLMS
FWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEEEETRQMYDMVVKIIVLDVL
RSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAVDFLAANESRVRTETRRI
GGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPNSLTPCLKIRNMFDPVME
IGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLSPEYAGKAFKALHGSWFD
GKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRLRTGLTNSQGSS
Download sequence
Identical sequences ENSPANP00000012243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]