SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012411 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012411
Domain Number 1 Region: 523-808
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-55
Family Protein kinases, catalytic subunit 0.00056
Further Details:      
 
Domain Number 2 Region: 40-257
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000051
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012411   Gene: ENSPANG00000023632   Transcript: ENSPANT00000009215
Sequence length 929
Comment pep:known_by_projection chromosome:PapAnu2.0:20:21364303:21387406:-1 gene:ENSPANG00000023632 transcript:ENSPANT00000009215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAARGSRPWPRLGLQLQFAVLLLGALSPQVHTLRPESLLLVSTLDGSLHALSKQTGDL
KWTLRDDPVIQGPMYVTEMAFLSDPADGSLYILGTQKQQGLMKLPFTIPELVHASPCRSS
DGVFYTGRKQDAWFVVDPESGETQMTLTTAGSSTPRLYIGRTRSPEYTVTMHDPRAPALR
WNTTYRRYSAPPMDGSPGKYMSHLASCGMGLLLTVDPESGAVLWTQDLGVPVMGVYTWHQ
DGLRQLPHLTLARDTLHFLALRWGHIRLPASGPQDTATLFSALDTQLLMTLYVGKDETGF
YVSKALVHTGVALVPRGLTLAPTDGPTTDEVTLQVSGEREGSPSTAVRYPSGSVALPSQW
LLIGHHELPPVLHTTMLRVHPTPGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHP
EEKIPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLVPADSADISQ
DAQSLHSGVTLRSQKRLQSPSKQAQPLDDPEAEQLTVVGKISFNPKDVLGRGAGGTFVFR
GQFEGRAVAVKRLLRECFGLVRREVQLLQESDRHPNVLRYFCTERGPQFHYIALELCRAS
LQEYVENPDLDRGGLEPEVVLQQLMSGLAHLHSLHIVHRDLKPGNILITGPDSQGLGRVV
LSDFGLCKKLPAGRCSFSLHSGIPGTEGWMAPELLQLLPPDSPTSAVDIFSAGCVFYYVL
SGGSHPFGDSLYRQANILTGVPCLAHLEEEVHDKVVAQDLVAAMLSLLPQARPSAPQVLA
HPFFWSRAKQLQFFQDVSDWLEKESEQEPLMRALEAGGCAVVRDNWHEHISMPLQTDLRK
FRSYKGTSVRDLLRAVRNKKHHYRELPVEVRQALGQVPDGFVQYFTNRFPQLLLHTHRVM
RSCASESLFLSYYPPVSEARGSCPGAAGR
Download sequence
Identical sequences ENSPANP00000012411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]