SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012521 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012521
Domain Number 1 Region: 117-219
Classification Level Classification E-value
Superfamily POZ domain 3.34e-18
Family Tetramerization domain of potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012521   Gene: ENSPANG00000018479   Transcript: ENSPANT00000021086
Sequence length 419
Comment pep:known_by_projection chromosome:PapAnu2.0:4:35765567:35787064:1 gene:ENSPANG00000018479 transcript:ENSPANT00000021086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVHRGSDSDRLLRQEASCLVDDTSVAAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYA
SQPANLQFPHIMSLAEDIKGSCFQSGNKWNHEPFIAPERFGNSSVGFGSNSHSQAPEKVT
LLVDGTRFVVNPQIFTAHPDTMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLD
YYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIRCQDLSALLHELSNDGAHKQFDHYLE
ELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIE
NRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPFIQMSWEKEEG
KSRHVDFQCVRSKSLTNLVAAGDDVLEDHEILMHHPPQVDELDRLNAPLSQMASNDFQD
Download sequence
Identical sequences A0A2I3MU58
ENSPANP00000012521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]