SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012568 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012568
Domain Number 1 Region: 17-180
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.49e-37
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012568   Gene: ENSPANG00000025501   Transcript: ENSPANT00000018730
Sequence length 184
Comment pep:known_by_projection chromosome:PapAnu2.0:4:38022671:38047490:-1 gene:ENSPANG00000025501 transcript:ENSPANT00000018730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPAMKFSLYFLAYEDKNDIPKDKEEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVHSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
Download sequence
Identical sequences A0A096NHX0 A0A2K5IEI6 A0A2K5NRE8 A0A2K5XM35 A0A2K6CHM9 A0A2K6QB47 F7GRZ9 G7P3D8 Q4R5F2
NP_001248693.1.72884 NP_001271981.1.63531 XP_010388021.1.97406 XP_011727639.1.29376 XP_011799781.1.43180 XP_011842020.1.47321 XP_011929594.1.92194 ENSMMUP00000002187 ENSPANP00000012568 9544.ENSMMUP00000002187 ENSMMUP00000002187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]