SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012686 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012686
Domain Number 1 Region: 71-319
Classification Level Classification E-value
Superfamily Kelch motif 2.48e-56
Family Kelch motif 0.01
Further Details:      
 
Domain Number 2 Region: 11-69
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000418
Family Kelch motif 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012686   Gene: ENSPANG00000009990   Transcript: ENSPANT00000012282
Sequence length 382
Comment pep:known_by_projection chromosome:PapAnu2.0:4:42390229:42397297:1 gene:ENSPANG00000009990 transcript:ENSPANT00000012282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLP
PVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACNVLYAFDVNTHKWFTPRV
SGTVPGARDGHSACVLGKIMYIFGGYEQQADCFSNDIHKLDTSTMTWTLICTKGNPARWR
DFHSATMLGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRR
SHSAFGYNGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVG
DKIVLFGGTSPSPEEGLGDEFDLIDHSDLHILDFSPSLKTLCKLAVIQYNLDQSCLPHDI
RWELNAMTTNSNISRPIVSSHG
Download sequence
Identical sequences A0A096NI88 A0A0D9RGK8 A0A2K5MK54 A0A2K5X3M5 A0A2K6AEV7 A0A2K6B6Q7 A0A2K6Q979 F7G0N8 G2HIN0 G3S6N3 H2PJ37
ENSPTRP00000031066 ENSPTRP00000031066 ENSPPYP00000018596 ENSMMUP00000033670 NP_001233443.1.37143 XP_002816954.2.23681 XP_005553016.1.63531 XP_007970711.1.81039 XP_007970712.1.81039 XP_008957022.1.60992 XP_009449539.1.37143 XP_010367998.1.97406 XP_011752795.1.29376 XP_011752796.1.29376 XP_011752797.1.29376 XP_011815795.1.43180 XP_011842136.1.47321 XP_011927697.1.92194 XP_014991895.1.72884 XP_014991896.1.72884 XP_015304878.1.63531 XP_018884561.1.27298 XP_018884562.1.27298 9600.ENSPPYP00000018596 ENSPANP00000012686 ENSPPYP00000018596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]