SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012723 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012723
Domain Number 1 Region: 272-515
Classification Level Classification E-value
Superfamily vWA-like 9.64e-84
Family Integrin A (or I) domain 0.000000406
Further Details:      
 
Domain Number 2 Region: 484-602
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-18
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 771-847
Classification Level Classification E-value
Superfamily Integrin beta tail domain 5.36e-18
Family Integrin beta tail domain 0.0021
Further Details:      
 
Domain Number 4 Region: 172-231
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000392
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 685-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000019
Family Integrin beta EGF-like domains 0.00059
Further Details:      
 
Domain Number 6 Region: 729-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000268
Family Integrin beta EGF-like domains 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012723
Domain Number - Region: 650-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.018
Further Details:      
 
Domain Number - Region: 607-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012723   Gene: ENSPANG00000023629   Transcript: ENSPANT00000010101
Sequence length 919
Comment pep:known_by_projection chromosome:PapAnu2.0:3:1776845:1825483:1 gene:ENSPANG00000023629 transcript:ENSPANT00000010101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPWGFSEDPQEKLQEAPTHSTCSVVAPELAGSKCNGIRPGSGSGSGWGKDHGVRGGGG
SEQLRAAGEGRRLPPWRLTLVPGGTSGKEAPRSSALGWDLPQPLQAAGSIPRATDWETEA
GAKPTAQPLPGLRPRPPPGSFPEAQGQEKDMLGLRPPLLALVGLLSLGCVLSQECTKFKV
SSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCPADDIMDPGSLAKTQED
HDGGQTQLSPQKVTLYLRPGQAAEFTVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLG
GDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPDKEKECQAPFAFRHVLKL
TSNSNQFQKEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFA
GDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTKKMVKTY
EKLTEIIPKSAVGELSDDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGV
TLKDQSRGDCDGVQINVPVTFRVKVTATECIQEQSFVIRALGFTDTVTVQVLPQCECRCR
DQSRDRSFCHGKGFLECGICRCDTGYIGKTCECQTQGRSSQELEGSCRKDNNSVICSGLG
DCVCGQCLCHTSDIPGKMIYGQYCECDTVNCERYNGQVCGGPARGLCFCGKCRCLQGFEG
SACQCERTTEGCLNARRVECSGRGRCRCNVCECERNYQPPLCQECPGCPSPCGEHISCAE
CLKFDKGPFGKNCSAACRRLQLSNNPVKGRTCKERDSEGCWVTYMLEQQDGWDHYIIYVD
ESRECVAGPNIAAIVGGTVAGIVLIGVLLLVIWKALTHLSDLREYRRFEKEKLKSQWNND
NPLFKSATTTVMNPKFAES
Download sequence
Identical sequences A0A096NIC5
ENSPANP00000012723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]