SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012780 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012780
Domain Number 1 Region: 274-639
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.22e-64
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 2 Region: 30-236,271-338
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.33e-26
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012780   Gene: ENSPANG00000006267   Transcript: ENSPANT00000023932
Sequence length 906
Comment pep:novel chromosome:PapAnu2.0:3:2573067:2596655:-1 gene:ENSPANG00000006267 transcript:ENSPANT00000023932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFAYRFSNLLGTVYRRGNLNFTCDGNSVISPVGNRVTVFDLKNNKSDTLPLATRYNVKC
VGLSPDGRLAIIVDEGGDALLVSLVCRSVLHHFHFKGSVHNVSFSPNGRKFVVTKGNIAQ
MYHAPGKKREFNAFVLDKTYFGPYDETTCIDWTDDSRCFVVGSKDMSTWVFGAERWDNLI
YYALGGHKDAIVACFFESNSLDLYSLSQDGVLCMWQCDTPPEGLRLKPPAGWKADLLQGD
RETTIRGKATPAEEEKTGKVKYSRLAKYFFNKEGDFNNLTAAAFHKKSHLLVTGFASGIF
HLHELPEFNLIHSLSISDQSIASVAINSSGDWIAFGCSGLGQLLVWEWQSESYVLKQQGH
FNSMVTLAYSPDGQYIVTGGDDGKVKVWNTLSGFCFVTFTEHSSGVTGVTFTATGYVVVT
SSMDGTVRAFDLHRYRNFRTFTSPRPTQFSCVAVDASGEIVSAGAQDSFEIFVWSMQTGR
LLDVLSGHEGPISGLCFNPMKSILASASWDKTVRLWDMFDSWRTKETLALTSDALAVTFR
PDGAELAVATLNSQITFWDPENAVQMGSIEGRHDLKTGRKELDKITAKHAAKGKAFTTLC
YSADGQSILAGGMSKFVCIYHVREQILMKRFEISCNLSLDAMEEFLNRRKMTEFGNLALI
DQDAGQEDGVAIPLPGVRKGDMSSRHFKPEIRVTSLRFSPTGRCWAATTTEGLLIYSLDT
RVLFDPFELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTS
SLPELYVEKVLEFLASSFEVSRHLEFYLVWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSI
QRHLDDLSKLCSWNRYNMQYALAVSKQRGTKRSLEPLGSEEEEASEDDSLHLLGGGGRDS
EEGMLA
Download sequence
Identical sequences ENSPANP00000012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]