SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012941 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000012941
Domain Number - Region: 4-74
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0439
Family BphP N-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012941   Gene: ENSPANG00000005251   Transcript: ENSPANT00000028905
Sequence length 121
Comment pep:known_by_projection chromosome:PapAnu2.0:13:9359522:9381145:-1 gene:ENSPANG00000005251 transcript:ENSPANT00000028905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAAAEAPGAAAEEASGRDPSPVAPPDGRDETLRLLDQLLAESAAWGPPEPAPRRPARP
RPTAVAGSAVSAEQSTEGHPGSGSVSEAPGSSGKKPERPAAISYDHAEEGLMASIEREYC
R
Download sequence
Identical sequences ENSPANP00000012941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]