SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012948 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012948
Domain Number 1 Region: 42-204
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.19e-50
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012948   Gene: ENSPANG00000011223   Transcript: ENSPANT00000000966
Sequence length 249
Comment pep:known_by_projection chromosome:PapAnu2.0:13:9725494:9735846:-1 gene:ENSPANG00000011223 transcript:ENSPANT00000000966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITNVINPALDKYFPADSGVRIIAEPGRYYV
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLL
QKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGF
QRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGMKRHPAACASAGSR
RAGSCQPSS
Download sequence
Identical sequences ENSPANP00000012948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]