SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013033 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013033
Domain Number 1 Region: 27-197
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.07e-43
Family Ribosomal protein S7 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013033   Gene: ENSPANG00000009988   Transcript: ENSPANT00000020913
Sequence length 198
Comment pep:novel chromosome:PapAnu2.0:3:12400363:12400999:1 gene:ENSPANG00000009988 transcript:ENSPANT00000020913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEWETAAPVVAETPDTKLSGKWMITNDDVQISDISLQDYIAVKEKYAKYLPHSAGPYAA
TCFCKAQCPTVEPLTNSMMMHGHNSKKLMTVHIIKRAFNFIHLLTGENPLQALVNTIING
GPQEDSTCIGQAVNMSPLHHVNQATWLLCAGTHEAAFQKIKTIAECLADELMNVTKGSSN
SYAIKKKDELEHVAKSNC
Download sequence
Identical sequences ENSPANP00000013033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]