SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013174 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013174
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-22
Family Kringle modules 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013174   Gene: ENSPANG00000012703   Transcript: ENSPANT00000021097
Sequence length 263
Comment pep:known_by_projection chromosome:PapAnu2.0:10:71872708:71885415:-1 gene:ENSPANG00000012703 transcript:ENSPANT00000021097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLLCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRCPETTSQALPTSTTEIEEAS
EGPGVDEMQVFAPANTLPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKMCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGSTPLMGQAGTPGA
Download sequence
Identical sequences A0A2I3MM51
ENSPANP00000013174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]