SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013211 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013211
Domain Number 1 Region: 343-494,536-697
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-48
Family WD40-repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 665-812
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000126
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013211   Gene: ENSPANG00000024110   Transcript: ENSPANT00000029297
Sequence length 813
Comment pep:known_by_projection chromosome:PapAnu2.0:7:156019958:156113857:1 gene:ENSPANG00000024110 transcript:ENSPANT00000029297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGLDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRK
GPTKARPLMQTLPLRTTVNNGTVLPKKSSGSLPSPSGARKETAVPTTKRLNRSVSLLNAC
KLNRSTPSNIKRTSSSERVSPGGRRESNGDSKGNRNRTGSTSSSSSGKKNSESKPKEPVF
SAEEGYVKMFLRGRPVTMYMPKDQVDSYSLEAKVELPTKRLKLEWVYPLFTDYVSRQLFL
TGAIIYLISSLAVLITLEEACRDHLSVYADSCYCIIFYLKLISLSTYILSTCFHPEKQLP
PHVRIWDSVTLNTLHVIGIGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQKEE
KLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTLEGSSLNKKQGLFEKQEKPKFVL
CVTFSENGDTITGDSSGNILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGKDR
KLISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQGH
TDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVAVG
TLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRKY
TRVGKCSGHSSFITHLDWSVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWATYT
CTLGFHVFGVWPEGSDGTDINAVSRAHEKKLLSTGDDFGKVHLFSYPCSQFRAPSHIYGG
HSSHVTNVDFLCEDSHLISTGGKDTSIMQWRVI
Download sequence
Identical sequences ENSPANP00000013211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]