SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013322 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013322
Domain Number 1 Region: 9-251,307-408
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 6.52e-80
Family Glutaminase/Asparaginase 0.000000408
Further Details:      
 
Domain Number 2 Region: 457-613
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-31
Family Ankyrin repeat 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013322   Gene: ENSPANG00000000882   Transcript: ENSPANT00000019084
Sequence length 628
Comment pep:known_by_projection chromosome:PapAnu2.0:7:160284874:160312125:1 gene:ENSPANG00000000882 transcript:ENSPANT00000019084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAVGSERRLLAVYTGGTIGMRSELGVLVPGTGLAAILRTLPMFHDEQHARACGLSEDI
LVLPPATPNQRILYTVLECQPLFDSSDMTITEWVRVAQTIERHYKQYHGFVVIHGTDTMA
FAASMLSFMLENLQKTVILTGAQVSIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTVNRELVRKVGGKAGLVVHSSMEQDVGL
LRLYPGIPAALRQRPPPDSSWLGAAPAVLDKGVCAGASDGLLGSSPTSLKCFHGVLPHKA
FVPTDRVRAFLQPPLKGMVMETFGSGNGPTKPDLLQELQMATKRGLVIVNCTHCLQGTVT
TDYAAGMAMEGAGVISGFDMTSEAALAKLSYVLGQPGLSLDDRKELLTKDLRGEMTPPSV
EECQPSLQGNTLGRGVSWLLSLSGSQEADALRNALMPSLACAAAHAGNLEVLQVLVELGS
DLGLVDFNGQTPLHAAARGGHVEAVTMLLQGGVDVNTRDTDGFSPLLLAVRGRHSGVIGL
LREAGASLSTQELEEAGTELCRLAYRADLEGLQVWWQAGADLGQPGYDGHSALHVAEAAG
NLAVVAFLQSLEGAVGAQVPCPEVLPGV
Download sequence
Identical sequences A0A096NK18
ENSPANP00000013322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]