SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013381 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013381
Domain Number 1 Region: 623-1150
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.48e-156
Family alpha-mannosidase, C-terminal domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 124-500
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-137
Family alpha-mannosidase 0.000000000906
Further Details:      
 
Domain Number 3 Region: 503-617
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 9.81e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013381   Gene: ENSPANG00000022247   Transcript: ENSPANT00000023792
Sequence length 1151
Comment pep:known_by_projection scaffold:PapAnu2.0:JH687279.1:161391:177919:-1 gene:ENSPANG00000022247 transcript:ENSPANT00000023792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPTRHQNGGNFPRSQISVLQNRIEQLEQL
LEENHEIISHIKDSVLELTANAEGPPAMLPYYTVNGSWVVPPEPRPSFFSISPQDCQFAL
GGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNINAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALIDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQTWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVAESRAALLLDQYRKKSRLFRSNVL
LVPLGDDFRYDKPQEWDAQFFNYQRLFDFFNSRPNLHVQAQFGTLSDYFDALYKRTGVEP
GARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEVLYSLAAAHS
RHSGLAGRYPLSDFTLLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVNLKQVI
IHAAHYLVLGDKETYHFDPEAPFLQVDDTRVSHDALPERTVIQLDSSPRFVVLFNPLEQE
RFSMVSLLVNSPRVRVLSEEGQPLAVQISAHWSSATEVVPDVYQVSVPVRLPALGLGVLQ
LQLGLDGHRTLPSSMRVYLHGRQLSVSRHEAFPLRIIDSGSSDFALSNRYMQVWFSGLTG
LLKSIRRVDEEQEQQVDMEFLVYGTRTSKDKSGAYLFLPDGEAKPYVPKEPPVLHVTEGP
FFSEVVAYYEHVHQVVRLYNLPGVEGLSLDISSLVDIRDYVNKELALRIHTDIDSQGIFF
TDLNGFQVQPRRYLKKLPLQANFYPMPVMAYIQDAHKRLTLHTAQALGVSSLKDGQLEVI
LDRRLMQDDNRGLGQGLKDNKRTCNRFRLLLERRTVGSEVQDSHSTSYPSLLSHLTSMYL
NTPALALPVARTQLPGPGLRSFHPLASSLPCDFHLLNLRTLQAEEDTLPSAEMALILHRK
GFDCGLEAKNLGFNCTTSQGKVALGSLFHGLDVVFLQPTSLTLLYPLASPSNSTDVYLEP
MEIATFRLRLG
Download sequence
Identical sequences ENSPANP00000013381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]