SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013438 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013438
Domain Number 1 Region: 29-225
Classification Level Classification E-value
Superfamily E set domains 2.13e-69
Family RhoGDI-like 0.000000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013438   Gene: ENSPANG00000020547   Transcript: ENSPANT00000021889
Sequence length 225
Comment pep:known chromosome:PapAnu2.0:20:163451:166819:1 gene:ENSPANG00000020547 transcript:ENSPANT00000021889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIR
QLDPDDRSLAEYKRALLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD
QVFVLKEGVDYRVKITFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFV
TPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLRICQDWKD
Download sequence
Identical sequences A0A096NKD1
ENSPANP00000013438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]