SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013618 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013618
Domain Number 1 Region: 946-1144
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000256
Family WD40-repeat 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013618
Domain Number - Region: 40-172
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00103
Family BAR domain 0.033
Further Details:      
 
Domain Number - Region: 532-585
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00123
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013618   Gene: ENSPANG00000018354   Transcript: ENSPANT00000009760
Sequence length 1313
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1587374:1651856:1 gene:ENSPANG00000018354 transcript:ENSPANT00000009760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSLPGRSPRQSWRKRKERPTSLNVFPLADGTVRAQMGGKLVPAGDH
WHLSDLGQLQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNETL
QPLGDYGVGSKSSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELD
MCPETRLDRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLGEFSVRDD
FFGMGKEVGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKL
ENRIKELEEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVL
MERNQYKERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRP
YPSVNIHYKSPTTAGFSQRRSHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVRE
HVRNDDGRLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAG
VNLSGWRPNEDDGGNGVKPAPGRDPLTCDREGDGEPKSAHGSPEKKKAKELPEMDATSSR
VWILTSTLTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDV
NPEDPGVDGVLAGEAAAIANGKVNPSQSTEEATEATEVPDPGPSEPETATLRPGPLTEHV
FTDPAPTPSSGPQPGSENGPEPDSSSTQPEPEPSGDPTGAGSSAAPTMWLGAQNGWLYVH
SAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADGTLAIFHRGEDGQWDLSNYHLMDLG
HPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEKSFDAHPRRESQVRQLAWIGDGVWV
SIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGKLGFSFVRITALLVAGSRLWVGTGN
GVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGARPGGIIHVYGDDSSDRAASSFIPYC
SMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSPAEGPGPAAPASEAEGQKLRNVL
VLSGGEGYIDFRIGDGEDDETEEGTGDISQVKPVLSKAERSHIIVWQVSYTPE
Download sequence
Identical sequences ENSPANP00000013618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]