SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013629 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013629
Domain Number 1 Region: 93-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-52
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013629
Domain Number - Region: 275-311
Classification Level Classification E-value
Superfamily SOCS box-like 0.00445
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013629   Gene: ENSPANG00000018349   Transcript: ENSPANT00000012943
Sequence length 355
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1660069:1664376:-1 gene:ENSPANG00000018349 transcript:ENSPANT00000012943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRPRSSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSALPPSIP
SAVPVTGESFCDCAGQSEASFCSNLHSAHRGKDCRCGEEDEYFDWVWDDLNKSSATLLSC
DNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRH
TFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCI
GVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLP
LPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT
Download sequence
Identical sequences A0A2K5KT77 A0A2K5YP27 F6Y7U9 G7Q060
9544.ENSMMUP00000024463 ENSPANP00000013629 ENSMMUP00000024463 NP_001245080.1.72884 XP_005590949.1.63531 XP_005590950.1.63531 XP_011822334.1.47321 XP_011889359.1.92194 XP_011889370.1.92194 XP_011889381.1.92194 XP_014980738.1.72884 XP_014980739.1.72884 XP_015297794.1.63531 ENSMMUP00000024463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]