SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013660 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013660
Domain Number 1 Region: 147-357
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.88e-59
Family Endonuclease III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013660   Gene: ENSPANG00000016971   Transcript: ENSPANT00000023075
Sequence length 360
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1926168:1934334:-1 gene:ENSPANG00000016971 transcript:ENSPANT00000023075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSPQESGMNALSARMLTRNRSLGPGAGPRGCGEEPAPPRRGEAAAGCGPQWLGFGRSAP
LPTFAPSKKTLPGRARWLTPVMTALWEAEAGGSREARKSHSPVKRRRKAQRLCVAYEGSD
SEKGEKAEPLKVPVWEPQDWQQQLVNIRAMRSKKDAPVDHLGVEHCYDSSAPPKVRRYQV
LLSLMLSSQTKDQVTAGAMQRLRAQGLTVDSILQTDDATLGKLIYPVGFWRSKVKYIKQT
STILQQRYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWT
KKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVRPRCQACLNQALCPAAQGL
Download sequence
Identical sequences ENSPANP00000013660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]